(data stored in ACNUC26070 zone)

EMBL: AF302494.KCNE3

AF302494.KCNE3       Location/Qualifiers
FT   CDS             306..617
FT                   /codon_start=1
FT                   /gene="KCNE3"
FT                   /product="voltage-gated K+ channel subunit MIRP2"
FT                   /db_xref="GOA:Q9Y6H6"
FT                   /db_xref="H-InvDB:HIT000076686.13"
FT                   /db_xref="HGNC:HGNC:6243"
FT                   /db_xref="InterPro:IPR000369"
FT                   /db_xref="InterPro:IPR005426"
FT                   /db_xref="PDB:2NDJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y6H6"
FT                   /protein_id="AAG16255.1"
FT                   /translation="METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEE
FT                   RRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI"
     METTNGTETW YESLHAVLKA LNATLHSNLL CRPGPGLGPD NQTEERRASL PGRDDNSYMY        60
     ILFVMFLFAV TVGSLILGYT RSRKVDKRSD PYHVYIKNRV SMI                         103
//

If you have problems or comments...

PBIL Back to PBIL home page