(data stored in ACNUC21562 zone)

EMBL: AF518244.MRGB6

AF518244.MRGB6       Location/Qualifiers
FT   CDS             3..>738
FT                   /codon_start=1
FT                   /gene="Mrgb6"
FT                   /product="MRGB6 G protein-coupled receptor"
FT                   /db_xref="GOA:Q7TN43"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TN43"
FT                   /protein_id="AAQ08316.1"
FT                   /translation="MDINISTLDIDIIELNGSNYTNTEICFVKIQVMSLLSLIICPVGM
FT                   VLNALVLWFLGFQMTRNAFSVYILNLAGADFFFLYSQFLFYILAIISYKYSISFRIPFL
FT                   FEVLAKVAYLSGLSILSTISIERCLCIMWPIWYRCQRPRHTSSVTCFLLWTLSLLFALL
FT                   EGAECGLLFNSFDQSRCLRFDLIFCAWSIVLFVVLCGSSLILLIRIFCGSQRIPVTRLY
FT                   VTIVLTVLFFLICCLPFGISWLI"
     MDINISTLDI DIIELNGSNY TNTEICFVKI QVMSLLSLII CPVGMVLNAL VLWFLGFQMT        60
     RNAFSVYILN LAGADFFFLY SQFLFYILAI ISYKYSISFR IPFLFEVLAK VAYLSGLSIL       120
     STISIERCLC IMWPIWYRCQ RPRHTSSVTC FLLWTLSLLF ALLEGAECGL LFNSFDQSRC       180
     LRFDLIFCAW SIVLFVVLCG SSLILLIRIF CGSQRIPVTR LYVTIVLTVL FFLICCLPFG       240
     ISWLI                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page