(data stored in ACNUC9306 zone)

EMBL: AF537266.PE1

AF537266.PE1         Location/Qualifiers
FT   CDS             1..1761
FT                   /codon_start=1
FT                   /product="ezrin"
FT                   /note="actin-binding protein; member of ERM family"
FT                   /db_xref="GOA:Q8HZQ5"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR008954"
FT                   /db_xref="InterPro:IPR011174"
FT                   /db_xref="InterPro:IPR011259"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035963"
FT                   /db_xref="InterPro:IPR041789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8HZQ5"
FT                   /protein_id="AAN06818.1"
FT                   /translation="MPKPINVRVTTMDAELEFAVQPNTTGKQLFDQVVKTIGLREVWYF
FT                   GLQYVDNKGFPTWLKLDKKVSAQEVRKENPVQFKFRAKFYPEDVSEELIQDITQKLFFL
FT                   QVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYSKEAHKAGYLSSERLIPQRVMDQHKL
FT                   SRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDA
FT                   LGLNIYEKNDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRIL
FT                   QLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLESEKKRREAVEQEKEQM
FT                   LREKEELMMRLQDYEQKTKKAEKELSDQIQRALQLEDERKRAQEESERLEADRVAALRA
FT                   KEELERQAADQIKSQEQLAAELAEYTAKIALLEEARRRKESEVEEWQHRAREAQDDLVK
FT                   TKEELHLVMTAPPPPPPPMYEPVSYHVQEHLHEEGAESLGYSAELSSEGILDDRHEEKR
FT                   ITEAEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENLRQGRDKYKTLRQIRQGNT
FT                   KQRIDEFEAM"
     MPKPINVRVT TMDAELEFAV QPNTTGKQLF DQVVKTIGLR EVWYFGLQYV DNKGFPTWLK        60
     LDKKVSAQEV RKENPVQFKF RAKFYPEDVS EELIQDITQK LFFLQVKEGI LSDEIYCPPE       120
     TAVLLGSYAV QAKFGDYSKE AHKAGYLSSE RLIPQRVMDQ HKLSRDQWED RIQVWHAEHR       180
     GMLKDSAMLE YLKIAQDLEM YGINYFEIKN KKGTDLWLGV DALGLNIYEK NDKLTPKIGF       240
     PWSEIRNISF NDKKFVIKPI DKKAPDFVFY APRLRINKRI LQLCMGNHEL YMRRRKPDTI       300
     EVQQMKAQAR EEKHQKQLER QQLESEKKRR EAVEQEKEQM LREKEELMMR LQDYEQKTKK       360
     AEKELSDQIQ RALQLEDERK RAQEESERLE ADRVAALRAK EELERQAADQ IKSQEQLAAE       420
     LAEYTAKIAL LEEARRRKES EVEEWQHRAR EAQDDLVKTK EELHLVMTAP PPPPPPMYEP       480
     VSYHVQEHLH EEGAESLGYS AELSSEGILD DRHEEKRITE AEKNERVQRQ LLTLSNELSQ       540
     ARDENKRTHN DIIHNENLRQ GRDKYKTLRQ IRQGNTKQRI DEFEAM                      586
//

If you have problems or comments...

PBIL Back to PBIL home page