(data stored in ACNUC7421 zone)

HOGENOMDNA: AGRRK_2.PE1

AGRRK_2.PE1          Location/Qualifiers
FT   CDS             190..1023
FT                   /locus_tag="Arad_0001"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:222084202"
FT                   /db_xref="GeneID:7371014"
FT                   /translation="MESSVENRTSFFHLHLISDSTGETLISAGRAASVQFHASQPIEHV
FT                   YPLIRNRKQLLPVLEAIDHSPGIVLYTIVDRELADFIDERCREMGVPCVNVLEPVMNVF
FT                   QTYLGTASRRRVGAQHVMNADYFARIEALNFTMDHDDGQMQDDYNDADVVIIGISRTSK
FT                   TPTSIYLANRGIKTANIPIIAGVPLPESLIQATRPLIVGLVATTDRISQVRENRILGAT
FT                   TGFDRGGYTDRATISEELKYARSLCARHNWPIIDVTRRSIEETAAAIVALRPKLR"
FT                   /protein_id="YP_002542727.1"
     MESSVENRTS FFHLHLISDS TGETLISAGR AASVQFHASQ PIEHVYPLIR NRKQLLPVLE        60
     AIDHSPGIVL YTIVDRELAD FIDERCREMG VPCVNVLEPV MNVFQTYLGT ASRRRVGAQH       120
     VMNADYFARI EALNFTMDHD DGQMQDDYND ADVVIIGISR TSKTPTSIYL ANRGIKTANI       180
     PIIAGVPLPE SLIQATRPLI VGLVATTDRI SQVRENRILG ATTGFDRGGY TDRATISEEL       240
     KYARSLCARH NWPIIDVTRR SIEETAAAIV ALRPKLR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page