(data stored in ACNUC7421 zone)

HOGENOMDNA: AGRVS_6.PE1

AGRVS_6.PE1          Location/Qualifiers
FT   CDS             203..1024
FT                   /locus_tag="Avi_0001"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:222147016"
FT                   /db_xref="GeneID:7387188"
FT                   /translation="MENRKNFFHLHLISDSTGETLISAGRAAAVQFPHSNPIEHVYPLV
FT                   RNRRQADAVLQSIDKEPGIVLYTIVDPELADFIDRRCIEIGVPSVNVLEPVIGTFQAYL
FT                   GPLARRRVGAQHVMNADYFARIEALNYTMDHDDGQMAEDYDQADVVLVGISRTSKTPTS
FT                   IYLANRGIKTANIPIVPDSPLPESLFAAKGPLIVGLIATSDRISQVRGHRELGTVSGFD
FT                   PSDYTDRASIAEELKYARSLCARHNWPVIDVTRRSIEETAAAIIALRAKPR"
FT                   /protein_id="YP_002547973.1"
     MENRKNFFHL HLISDSTGET LISAGRAAAV QFPHSNPIEH VYPLVRNRRQ ADAVLQSIDK        60
     EPGIVLYTIV DPELADFIDR RCIEIGVPSV NVLEPVIGTF QAYLGPLARR RVGAQHVMNA       120
     DYFARIEALN YTMDHDDGQM AEDYDQADVV LVGISRTSKT PTSIYLANRG IKTANIPIVP       180
     DSPLPESLFA AKGPLIVGLI ATSDRISQVR GHRELGTVSG FDPSDYTDRA SIAEELKYAR       240
     SLCARHNWPV IDVTRRSIEE TAAAIIALRA KPR                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page