(data stored in ACNUC1829 zone)

EMBL: AH004897.CD37

AH004897.CD37        Location/Qualifiers
FT   CDS             join(57..125,213..285,428..552,635..709,1031..1135,
FT                   1538..1774,2034..2117,2273..2350)
FT                   /codon_start=1
FT                   /gene="Cd37"
FT                   /product="leukocyte surface antigen CD37"
FT                   /protein_id="AAB39500.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREGCAQSLQKWLHNNIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
FT                   "
     MSAQESCLSL IKYFLFVFNL FFFVLGGLIF CFGTWILIDK TSFVSFVGLS FVPLQTWSKV        60
     LAVSGVLTMA LALLGCVGAL KELRCLLGLY FGMLLLLFAT QITLGILIST QRVRLERRVQ       120
     ELVLRTIQSY RTNPDETAAE ESWDYAQFQL RCCGWQSPRD WNKAQMLKAN ESEEPFVPCS       180
     CYNSTATNDS TVFDKLFFSQ LSRLGPRAKL RQTADICALP AKAHIYREGC AQSLQKWLHN       240
     NIISIVGICL GVGLLELGFM TLSIFLCRNL DHVYDRLARY R                           281
//

If you have problems or comments...

PBIL Back to PBIL home page