(data stored in ACNUC8465 zone)

EMBL: AH006187.MKK4

AH006187.MKK4        Location/Qualifiers
FT   CDS             join(115..229,418..520,795..969,1233..1352,1604..1723,
FT                   1911..1962,2216..2343,2584..2661,2945..3093,3313..3358,
FT                   3589..3702)
FT                   /codon_start=1
FT                   /gene="MKK4"
FT                   /product="mitogen-activated protein kinase kinase 1"
FT                   /note="tumor-suppressor"
FT                   /protein_id="AAC24130.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
     MAAPSPSGGG GSGGGSGSGT PGPVGSPAPG HPAVSSMQGK RKALKLNFAN PPFKSTARFT        60
     LNPNPTGVQN PHIERLRTHS IESSGKLKIS PEQHWDFTAE DLKDLGEIGR GAYGSVNKMV       120
     HKPSGQIMAV KRIRSTVDEK EQKQLLMDLD VVMRSSDCPY IVQFYGALFR EGDCWICMEL       180
     MSTSFDKFYK YVYSVLDDVI PEEILGKITL ATVKALNHLK ENLKIIHRDI KPSNILLDRS       240
     GNIKLCDFGI SGQLVDSIAK TRDAGCRPYM APERIDPSAS RQGYDVRSDV WSLGITLYEL       300
     ATGRFPYPKW NSVFDQLTQV VKGDPPQLSN SEEREFSPSF INFVNLCLTK DESKRPKYKE       360
     LLKHPFILMY EERAVEVACY VCKILDQMPA TPSSPMYVD                              399
//

If you have problems or comments...

PBIL Back to PBIL home page