(data stored in ACNUC31183 zone)

EMBL: AJ628446.RAP1GA2

AJ628446.RAP1GA2     Location/Qualifiers
FT   CDS             91..2283
FT                   /gene="RAP1GA2"
FT                   /product="Rap1 GTPase activating protein 2b"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000249324_01.9"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="CAF31652.1"
FT                   /translation="MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLS
FT                   PPLTAPPTMKSSEFFEMLEKMQGIKLEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQV
FT                   ILPQFGGYWIEDPENVGTPTSLGSSICEEEEEDNLSPNTFGYKLECKGEARAYRRHFLG
FT                   KDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPSVPQ
FT                   IAKAFCDDAVGLRFNPVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGNN
FT                   EESPAFKEFLDLLGDTITLQDFNGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLP
FT                   FTDGDAQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSY
FT                   KVSVTAREDVPTFGPPLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRA
FT                   ALLDNLHDELHAHTQAMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSMETMVGGQKK
FT                   SHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLFPRLHTGSEG
FT                   QGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKENGRAIS
FT                   RSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATP
FT                   IIMSRSPTDAKSRNSPRSNLKFRFDKLSHASSGAGH"
     MFGRKRSVSF GGFGWIDKTM LASLKVKKQE LANSSDATLP DRPLSPPLTA PPTMKSSEFF        60
     EMLEKMQGIK LEEQKPGPQK NKDDYIPYPS IDEVVEKGGP YPQVILPQFG GYWIEDPENV       120
     GTPTSLGSSI CEEEEEDNLS PNTFGYKLEC KGEARAYRRH FLGKDHLNFY CTGSSLGNLI       180
     LSVKCEEAEG IEYLRVILRS KLKTVHERIP LAGLSKLPSV PQIAKAFCDD AVGLRFNPVL       240
     YPKASQMIVS YDEHEVNNTF KFGVIYQKAR QTLEEELFGN NEESPAFKEF LDLLGDTITL       300
     QDFNGFRGGL DVTHGQTGVE SVYTTFRDRE IMFHVSTKLP FTDGDAQQLQ RKRHIGNDIV       360
     AIIFQEENTP FVPDMIASNF LHAYIVVQVE TPGTETPSYK VSVTAREDVP TFGPPLPSPP       420
     VFQKGPEFRE FLLTKLTNAE NACCKSDKFA KLEDRTRAAL LDNLHDELHA HTQAMLGLGP       480
     EEDKFENGGH GGFLESFKRA IRVRSHSMET MVGGQKKSHS GGIPGSLSGG ISHNSMEVTK       540
     TTFSPPVVAA TVKNQSRSPI KRRSGLFPRL HTGSEGQGDS RARCDSTSST PKTPDGGHSS       600
     QEIKSETSSN PSSPEICPNK EKPFMKLKEN GRAISRSSSS TSSVSSTAGE GEAMEEGDSG       660
     GSQPSTTSPF KQEVFVYSPS PSSESPSLGA AATPIIMSRS PTDAKSRNSP RSNLKFRFDK       720
     LSHASSGAGH                                                              730
//

If you have problems or comments...

PBIL Back to PBIL home page