(data stored in ACNUC31108 zone)

EMBL: AJ851687.PE1

AJ851687.PE1         Location/Qualifiers
FT   CDS             243..743
FT                   /locus_tag="RCJMB04_17m6"
FT                   /product="hypothetical protein"
FT                   /note="ORF1"
FT                   /db_xref="GOA:Q5F3G3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="UniProtKB/TrEMBL:Q5F3G3"
FT                   /protein_id="CAH65321.1"
FT                   /translation="MMFVGFLGCYGAIQESQCLLGAFFTCLVILFACEVAAGIWGFVNK
FT                   DQIAKDVKQFYDQAFQQALMADSDSSNGKAVVKTFHETLDCCGPDTMVGTLTPLWRDDL
FT                   CSKDLLKGLLKREENCHKKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNS
FT                   SVY"
     MMFVGFLGCY GAIQESQCLL GAFFTCLVIL FACEVAAGIW GFVNKDQIAK DVKQFYDQAF        60
     QQALMADSDS SNGKAVVKTF HETLDCCGPD TMVGTLTPLW RDDLCSKDLL KGLLKREENC       120
     HKKIDELFSG KLYLIGIAAI VVAVIMIFEM ILSMVLCCGI RNSSVY                      166
//

If you have problems or comments...

PBIL Back to PBIL home page