(data stored in ACNUC21562 zone)

EMBL: AK029369.PE1

AK029369.PE1         Location/Qualifiers
FT   CDS             68..1084
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="MrgB2 G protein-coupled receptor (SPTR|Q91ZC2,
FT                   evidence: FASTY, 99.7%ID, 100%length, match=1014)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3KNA1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2441674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KNA1"
FT                   /protein_id="BAC26422.1"
FT                   /translation="MSGDFLIKNLSTSAWKTNITVLNGSYYFDTSVCVTRNQAMILLSI
FT                   IISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSI
FT                   DINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVM
FT                   SLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQR
FT                   IPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCM
FT                   NPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS"
     MSGDFLIKNL STSAWKTNIT VLNGSYYFDT SVCVTRNQAM ILLSIIISLV GMGLNAIVLW        60
     FLGIRMHTNA FTVYILNLAM ADFLYLCSQF VICLLIAFYI FYSIDINIPL VLYVVPIFAY       120
     LSGLSILSTI SIERCLSVIW PIWYRCKRPR HTSAITCFVL WVMSLLLGLL EGKACGLLFN       180
     SFDSYWCETF DVITNIWSVV FFGVLCGSSL TLLVRIFCGS QRIPMTRLYV TITLTVLVFL       240
     IFGLPFGIYW ILYQWISNFY YVEICNFYLE ILFLSCVNSC MNPIIYFLVG SIRHRRFRRK       300
     TLKLLLQRAM QDTPEEEQSG NKSSSEHPEE LETVQSCS                               338
//

If you have problems or comments...

PBIL Back to PBIL home page