(data stored in ACNUC31108 zone)

EMBL: AK053788.PE1

AK053788.PE1         Location/Qualifiers
FT   CDS             256..1017
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="weakly similar to PLATELET-ENDOTHELIAL TETRASPAN
FT                   ANTIGEN 3 (PETA-3) (GP27) (MEMBRANE GLYCOPROTEIN SFA-1)
FT                   (CD151 ANTIGEN) [Homo sapiens] (SWISSPROT|P48509, evidence:
FT                   FASTY, 59.2%ID, 94%length, match=714)"
FT                   /db_xref="GOA:Q9D1D1"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="MGI:MGI:1915748"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1D1"
FT                   /protein_id="BAC35523.1"
FT                   /translation="MAHCKTEQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEK
FT                   SGYLSILASSTFAASAYILIFVGGLVMTTGFLGFGAIIREQKSCLSTYFCLLLVIFLVE
FT                   LVAGVLAHVYYQRLSDELKWHLNSTLTEHYGQPRAAEITASVDRLQQDFKCCGSNSSAD
FT                   WQHSAYILSQEALGRQVPDSCCKTVVARCGQRAHPSNIYKVEGGCMAKLEQFVADHLLL
FT                   MGAVGIGVACLQICGMVLTCCLHRRLQQQFY"
     MAHCKTEQDD WLLAHLKYLL FIFNFFFWVG GAAVMAVGIW TLVEKSGYLS ILASSTFAAS        60
     AYILIFVGGL VMTTGFLGFG AIIREQKSCL STYFCLLLVI FLVELVAGVL AHVYYQRLSD       120
     ELKWHLNSTL TEHYGQPRAA EITASVDRLQ QDFKCCGSNS SADWQHSAYI LSQEALGRQV       180
     PDSCCKTVVA RCGQRAHPSN IYKVEGGCMA KLEQFVADHL LLMGAVGIGV ACLQICGMVL       240
     TCCLHRRLQQ QFY                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page