(data stored in ACNUC27125 zone)

EMBL: AK133393.PE1

AK133393.PE1         Location/Qualifiers
FT   CDS             244..1785
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 3, catalytic subunit, gamma
FT                   isoform (MGD|MGI:107162 GB|NM_008915, evidence: BLASTN,
FT                   99%, match=1945)"
FT                   /note="putative"
FT                   /db_xref="GOA:P48455"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="MGI:MGI:107162"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48455"
FT                   /protein_id="BAE21630.1"
FT                   /translation="MSVRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDLLKNH
FT                   LVKEGRVEEEVALKIINDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMKLFEVGGSP
FT                   SNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECR
FT                   IKYSEMVYDACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFSEPPAFGP
FT                   VCDLLWSDPLEDYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQD
FT                   AGYRMYRKNQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLP
FT                   NFMDVFTWSLPFVGEKVTEMLVNILNICSDEEMNVTDEEGATTGRKEVIKNKIRAIGKM
FT                   ARVFTVLREESENVLTLKGLTPTGTLPLGVLSGGKQTIETAKQEAAEEREAIRGFTIAH
FT                   RIRSFEEARGLDRINERMPPRKEASYHHDAGRMHSHSHPPHPQASRRTDHGKKAL"
     MSVRRPQFST TERVIKAVPF PPTRRLTLKE VFENGKPKMD LLKNHLVKEG RVEEEVALKI        60
     INDGAAILKQ EKTMIEVEAP ITVCGDVHGQ FFDLMKLFEV GGSPSNTRYL FLGDYVDRGY       120
     FSIECVLYLW SLKINHPKTL FLLRGNHECR HLTEYFTFKQ ECRIKYSEMV YDACMHTFDC       180
     LPLAALLNQQ FLCVHGGMSP EITCLEDIRK LDRFSEPPAF GPVCDLLWSD PLEDYGSEKT       240
     LEHYTHNTVR GCSYFFSYPA VCEFLQNNSL LSIIRAHEAQ DAGYRMYRKN QATGFPSLIT       300
     IFSAPNYLDV YNNKAAVLKY ENNVMNIRQF NCSPHPYWLP NFMDVFTWSL PFVGEKVTEM       360
     LVNILNICSD EEMNVTDEEG ATTGRKEVIK NKIRAIGKMA RVFTVLREES ENVLTLKGLT       420
     PTGTLPLGVL SGGKQTIETA KQEAAEEREA IRGFTIAHRI RSFEEARGLD RINERMPPRK       480
     EASYHHDAGR MHSHSHPPHP QASRRTDHGK KAL                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page