(data stored in ACNUC1829 zone)

EMBL: AK155663.PE1

AK155663.PE1         Location/Qualifiers
FT   CDS             89..847
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="CD37 antigen (MGD|MGI:88330 GB|NM_007645, evidence:
FT                   BLASTN, 99%, match=772)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U1W9"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:88330"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1W9"
FT                   /protein_id="BAE33374.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVS
FT                   FVGLSFVPLQTWSKVLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNK
FT                   AQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAK
FT                   AHIYREVGLAVASSSGRVGLGLEPSGGRDF"
     MSAQESCLSL IKYFLFVFNL FFFVLGGLIF CFGTWILIDK TSFVSFVGLS FVPLQTWSKV        60
     LAVSGVLTMA LALLGCVGAL KELRCLLGLY FGMLLLLFAT QITLGILIST QRVRLERRVQ       120
     ELVLRTIQSY RTNPDETAAE ESWDYAQFQL RCCGWQSPRD WNKAQMLKAN ESEEPFVPCS       180
     CYNSTATNDS TVFDKLFFSQ LSRLGPRAKL RQTADICALP AKAHIYREVG LAVASSSGRV       240
     GLGLEPSGGR DF                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page