(data stored in ACNUC1829 zone)

EMBL: AK158729.PE1

AK158729.PE1         Location/Qualifiers
FT   CDS             68..787
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Tetraspan NET-5 homolog (Hypothetical protein)
FT                   (UniProt|Q8BJU2, evidence: FASTY, 100%ID, 100%length,
FT                   match=717)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BJU2"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1924558"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJU2"
FT                   /protein_id="BAE34632.1"
FT                   /translation="MARGCLCCLKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFS
FT                   PSFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILIILF
FT                   FVYMDKVNENAKQDLKEGLLLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGEN
FT                   TVPDRCCMENSQGCGRNSTTPLWRTGCYEKVKLWFDDNKHVLGTVGMCILIMQILGMAF
FT                   SMTLFQHIHRTGKKYDA"
     MARGCLCCLK YTMFLFNLIF WLCGCGLLGV GIWLSVSQGN FATFSPSFPS LSAANLVIAI        60
     GTIVMVTGFL GCLGAIKENK CLLLSFFIVL LIILLAELIL IILFFVYMDK VNENAKQDLK       120
     EGLLLYNTEN NVGLKNAWNI IQAEMRCCGV TDYTDWYPVL GENTVPDRCC MENSQGCGRN       180
     STTPLWRTGC YEKVKLWFDD NKHVLGTVGM CILIMQILGM AFSMTLFQHI HRTGKKYDA        239
//

If you have problems or comments...

PBIL Back to PBIL home page