(data stored in SCRATCH zone)

EMBL: AK228471.AT5G01090

AK228471.AT5G01090   Location/Qualifiers
FT   CDS             216..1277
FT                   /codon_start=1
FT                   /gene="At5g01090"
FT                   /product="lectin-like protein"
FT                   /db_xref="GOA:Q9LFC7"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC7"
FT                   /protein_id="BAF00398.1"
FT                   /translation="MAVFKTLAFLFVLSIVIYQSVAVTDVNSSFSFNGFVKAPSFDNNV
FT                   ALFGDSKLVHGGPSIQLTDSVSRSEGRVIYKKPIRLFQGKERNFSGSFSTSFSFSMSDE
FT                   IGSVLAFIMVPRGLDLRLFGRKGNNSSSGLGFLLKHKVVAVEFGISKRGNHVGILVGRP
FT                   ESGKVRKLSSFGHHFNEEKRLNCWIDYEASSKRIEVRLSLSAALKPVDPFVSYSVDLAK
FT                   LWKDGKFMVGLTSANGNTSKPVYLHSWSFKLRHPSMRIHSQPLDPNDVSKTVKEGEKTV
FT                   EVKGKGKCIWRILGALVLGAVCGTLGAMFALYLWTICGNRQSMAIVPEECADEKADILV
FT                   TKADVVVEEEVKK"
     MAVFKTLAFL FVLSIVIYQS VAVTDVNSSF SFNGFVKAPS FDNNVALFGD SKLVHGGPSI        60
     QLTDSVSRSE GRVIYKKPIR LFQGKERNFS GSFSTSFSFS MSDEIGSVLA FIMVPRGLDL       120
     RLFGRKGNNS SSGLGFLLKH KVVAVEFGIS KRGNHVGILV GRPESGKVRK LSSFGHHFNE       180
     EKRLNCWIDY EASSKRIEVR LSLSAALKPV DPFVSYSVDL AKLWKDGKFM VGLTSANGNT       240
     SKPVYLHSWS FKLRHPSMRI HSQPLDPNDV SKTVKEGEKT VEVKGKGKCI WRILGALVLG       300
     AVCGTLGAMF ALYLWTICGN RQSMAIVPEE CADEKADILV TKADVVVEEE VKK              353
//

If you have problems or comments...

PBIL Back to PBIL home page