(data stored in ACNUC30567 zone)

EMBL: AK293382.PE1

AK293382.PE1         Location/Qualifiers
FT   CDS             589..1512
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="highly similar to ADAM 28 precursor (EC 3.4.24.-)
FT                   (Adisintegrin and metalloproteinase domain 28)"
FT                   /db_xref="GOA:B4DDY3"
FT                   /db_xref="H-InvDB:HIT000488006.4"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:B4DDY3"
FT                   /protein_id="BAG56894.1"
FT                   /translation="MANYVNMLYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSK
FT                   WRGSVLSRRKRHDIAQLITATELAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTM
FT                   AHEMGHNFGMFHDDYSCKCPSTICVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLF
FT                   NAPLPTDIISTPICGNQLVEMGEDCDCGTSEECTNICCDAKTCKIKATFQCALGECCEK
FT                   CQFKKAGMVCRPAKDECDLPEMCNGKSGNCPDDRFQVNGFPCHHGKGHCLMGTCPTLQE
FT                   QCTELWGPGRRTNPFPCACAKENHFR"
     MANYVNMLYK KLNTHVALVG MEIWTDKDKI KITPNASFTL ENFSKWRGSV LSRRKRHDIA        60
     QLITATELAG TTVGLAFMST MCSPYSVGVV QDHSDNLLRV AGTMAHEMGH NFGMFHDDYS       120
     CKCPSTICVM DKALSFYIPT DFSSCSRLSY DKFFEDKLSN CLFNAPLPTD IISTPICGNQ       180
     LVEMGEDCDC GTSEECTNIC CDAKTCKIKA TFQCALGECC EKCQFKKAGM VCRPAKDECD       240
     LPEMCNGKSG NCPDDRFQVN GFPCHHGKGH CLMGTCPTLQ EQCTELWGPG RRTNPFPCAC       300
     AKENHFR                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page