(data stored in SCRATCH zone)

EMBL: AL009126.ADAA

AL009126.ADAA        Location/Qualifiers
FT   CDS             203729..204364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /locus_tag="BSU_01810"
FT                   /old_locus_tag="BSU01810"
FT                   /product="methylphosphotriester-DNA alkyltransferase and
FT                   transcriptional regulator (AraC/XylS family)"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1744039, 2120677, 7565865,
FT                   8376346; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11957"
FT                   /db_xref="GOA:P19219"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="SubtiList:BG10166"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19219"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1744039, 2120677, 7565865, 8376346"
FT                   /protein_id="CAB11957.1"
FT                   /translation="MPDSINNGHKESHDHRISNDAEMITDEKWQAIINNDAAYNNQFFY
FT                   AVKSTGIFCKPSCKSRVPKKENVCIFPNTEQALRANFRPCKRCKPTNEKMPDSEWVDLI
FT                   TEYIDKNFTEKLTLESLADICHGSPYHMHRTFKKIKGITLVEYIQQVRVHAAKKYLIQT
FT                   NKAIGDIAICVGIANAPYFITLFKKKTGQTPARFRQMSKMEETYNGNK"
     MPDSINNGHK ESHDHRISND AEMITDEKWQ AIINNDAAYN NQFFYAVKST GIFCKPSCKS        60
     RVPKKENVCI FPNTEQALRA NFRPCKRCKP TNEKMPDSEW VDLITEYIDK NFTEKLTLES       120
     LADICHGSPY HMHRTFKKIK GITLVEYIQQ VRVHAAKKYL IQTNKAIGDI AICVGIANAP       180
     YFITLFKKKT GQTPARFRQM SKMEETYNGN K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page