(data stored in SCRATCH zone)

EMBL: AL009126.ADAB

AL009126.ADAB        Location/Qualifiers
FT   CDS             204351..204890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaB"
FT                   /locus_tag="BSU_01820"
FT                   /old_locus_tag="BSU01820"
FT                   /product="O6-methylguanine-DNA methyltransferase; prophage
FT                   1 region"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1744039, 2120677, 7565865,
FT                   8376346; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11958"
FT                   /db_xref="GOA:P19220"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="SubtiList:BG10167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19220"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1744039, 2120677, 7565865, 8376346"
FT                   /protein_id="CAB11958.1"
FT                   /translation="METNKPTLYWSLLMFKDWNFYIASTLKGLVFVGSQNKPIEELFEW
FT                   ARKRFPGSLLVEDDDKLEPYAVEITQYLEGKRKNFTVPVEYAGTQFQLAVWNALCEIPY
FT                   GQTKSYSDIANDINKPAAVRAVGAAIGANPVLITVPCHRVIGKNGSLTGYRGGFEMKTL
FT                   LLDLEKRASSEMDVPH"
     METNKPTLYW SLLMFKDWNF YIASTLKGLV FVGSQNKPIE ELFEWARKRF PGSLLVEDDD        60
     KLEPYAVEIT QYLEGKRKNF TVPVEYAGTQ FQLAVWNALC EIPYGQTKSY SDIANDINKP       120
     AAVRAVGAAI GANPVLITVP CHRVIGKNGS LTGYRGGFEM KTLLLDLEKR ASSEMDVPH        179
//

If you have problems or comments...

PBIL Back to PBIL home page