(data stored in ACNUC7421 zone)

EMBL: AL009126.ADK

AL009126.ADK         Location/Qualifiers
FT   CDS             145877..146530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BSU_01370"
FT                   /old_locus_tag="BSU01370"
FT                   /product="adenylate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.7: Manage energy"
FT                   /EC_number="2.7.4.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8061005, 8288548, 9056261,
FT                   9715904, 11106368, 16452168; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11913"
FT                   /db_xref="GOA:P16304"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="PDB:1P3J"
FT                   /db_xref="PDB:2EU8"
FT                   /db_xref="PDB:2OO7"
FT                   /db_xref="PDB:2ORI"
FT                   /db_xref="PDB:2OSB"
FT                   /db_xref="PDB:2P3S"
FT                   /db_xref="PDB:2QAJ"
FT                   /db_xref="PDB:3DKV"
FT                   /db_xref="PDB:3DL0"
FT                   /db_xref="PDB:4MKF"
FT                   /db_xref="PDB:4MKG"
FT                   /db_xref="PDB:4MKH"
FT                   /db_xref="PDB:4QBF"
FT                   /db_xref="PDB:4QBG"
FT                   /db_xref="PDB:4TYP"
FT                   /db_xref="PDB:4TYQ"
FT                   /db_xref="PDB:5X6I"
FT                   /db_xref="SubtiList:BG10446"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16304"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8061005, 8288548, 9056261, 9715904, 11106368,
FT                   16452168"
FT                   /protein_id="CAB11913.1"
FT                   /translation="MNLVLMGLPGAGKGTQGERIVEDYGIPHISTGDMFRAAMKEETPL
FT                   GLEAKSYIDKGELVPDEVTIGIVKERLGKDDCERGFLLDGFPRTVAQAEALEEILEEYG
FT                   KPIDYVINIEVDKDVLMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADD
FT                   NEETVSKRLEVNMKQTQPLLDFYSEKGYLANVNGQQDIQDVYADVKDLLGGLKK"
     MNLVLMGLPG AGKGTQGERI VEDYGIPHIS TGDMFRAAMK EETPLGLEAK SYIDKGELVP        60
     DEVTIGIVKE RLGKDDCERG FLLDGFPRTV AQAEALEEIL EEYGKPIDYV INIEVDKDVL       120
     MERLTGRRIC SVCGTTYHLV FNPPKTPGIC DKDGGELYQR ADDNEETVSK RLEVNMKQTQ       180
     PLLDFYSEKG YLANVNGQQD IQDVYADVKD LLGGLKK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page