(data stored in ACNUC7421 zone)

EMBL: AL009126.ALKA

AL009126.ALKA        Location/Qualifiers
FT   CDS             complement(202547..203458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="BSU_01800"
FT                   /old_locus_tag="BSU01800"
FT                   /product="DNA-3-methyladenine glycosylase; prophage 1
FT                   region"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.2.2.21"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7565865, 8376346, 16468998;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11956"
FT                   /db_xref="GOA:P37878"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="SubtiList:BG10165"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37878"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7565865, 8376346, 16468998"
FT                   /protein_id="CAB11956.1"
FT                   /translation="MTWHEVNDVIVITLPEIFDMNANLGYLTREKNECMYEIENNIITK
FT                   VIAIGEIRSLVQVSVINNKQMIVQFLNDSRPVEQWKREEIVKYIHEWFDLDNDLTPFYE
FT                   MAKADPLLKMPARKFYGLRVIGIPDLFEALCWGVLGQQINLAFAYSLKKQFVEAFGDSI
FT                   EWNGKKYWVFPPYERIARLTPTDLADIKMTVKKSEYIIGIARLMASGELSREKLMKMNF
FT                   KDAEKNLIKIRGIGPWTANYVLMRCLRFPTAFPIDDVGLIHSIKILRNMNRKPTKDEIL
FT                   EISVPWKEWQSYATFYLWRVLY"
     MTWHEVNDVI VITLPEIFDM NANLGYLTRE KNECMYEIEN NIITKVIAIG EIRSLVQVSV        60
     INNKQMIVQF LNDSRPVEQW KREEIVKYIH EWFDLDNDLT PFYEMAKADP LLKMPARKFY       120
     GLRVIGIPDL FEALCWGVLG QQINLAFAYS LKKQFVEAFG DSIEWNGKKY WVFPPYERIA       180
     RLTPTDLADI KMTVKKSEYI IGIARLMASG ELSREKLMKM NFKDAEKNLI KIRGIGPWTA       240
     NYVLMRCLRF PTAFPIDDVG LIHSIKILRN MNRKPTKDEI LEISVPWKEW QSYATFYLWR       300
     VLY                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page