(data stored in SCRATCH zone)

EMBL: AL009126.AMHX

AL009126.AMHX        Location/Qualifiers
FT   CDS             complement(324038..325189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BSU_03010"
FT                   /old_locus_tag="BSU03010"
FT                   /product="putative amidohydrolase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 8768514; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03010"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12095"
FT                   /db_xref="GOA:P54983"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="SubtiList:BG11789"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54983"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12095.2"
FT                   /translation="MQKLSEEMKQTIMDIFEHLHANPEVSWKEYETTSFLKQKLEDLGC
FT                   RTRTFSDCTGVVGEIGSGSPVVAVRADIDALWQEVNGTFRANHSCGHDSHMTMALGTLM
FT                   LLKKQPELPKGTIRFIFQPAEEKGGGALKMIEEGVLDDIDYLYGVHVRPIQETQNGRCA
FT                   PSILHGSSQHIEGTIIGEEAHGARPHLGKNSIEIAAFLVHKLGLIHIDPQIPHTVKMTK
FT                   LQAGGESSNIIPGKASFSLDLRAQTNEAMEALIAETERACEAAAAAFGAKIELHKEHSL
FT                   PAATQNKEAEAIMAEAITEIIGAERLDDPLVTTGGEDFHFYAVKVPNLKTTMLGLGCGL
FT                   QPGLHHPHMTFDRNAMFTGIHILANAVLKTFQKAESLAAANAS"
     MQKLSEEMKQ TIMDIFEHLH ANPEVSWKEY ETTSFLKQKL EDLGCRTRTF SDCTGVVGEI        60
     GSGSPVVAVR ADIDALWQEV NGTFRANHSC GHDSHMTMAL GTLMLLKKQP ELPKGTIRFI       120
     FQPAEEKGGG ALKMIEEGVL DDIDYLYGVH VRPIQETQNG RCAPSILHGS SQHIEGTIIG       180
     EEAHGARPHL GKNSIEIAAF LVHKLGLIHI DPQIPHTVKM TKLQAGGESS NIIPGKASFS       240
     LDLRAQTNEA MEALIAETER ACEAAAAAFG AKIELHKEHS LPAATQNKEA EAIMAEAITE       300
     IIGAERLDDP LVTTGGEDFH FYAVKVPNLK TTMLGLGCGL QPGLHHPHMT FDRNAMFTGI       360
     HILANAVLKT FQKAESLAAA NAS                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page