(data stored in ACNUC7421 zone)

EMBL: AL009126.AMIE

AL009126.AMIE        Location/Qualifiers
FT   CDS             complement(188408..189733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="BSU_01670"
FT                   /old_locus_tag="BSU01670"
FT                   /product="amidase hydrolyzing N-acetylmuramyl-L-Ala bond of
FT                   MurNAc peptides"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16452451, 20400549; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11943"
FT                   /db_xref="GOA:O05213"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="SubtiList:BG11566"
FT                   /db_xref="UniProtKB/Swiss-Prot:O05213"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16452451, 20400549"
FT                   /protein_id="CAB11943.2"
FT                   /translation="MKTKTLFIFSAILTLSIFAPNETFAQTAGNLIEPKIINAETAQFS
FT                   TKKLRKVDQMIERDIAAGFPGAVLVVVKDGRIIKKAAYGYSKKYEGSELLRRPAKMKTR
FT                   TMFDLASNTKMYATNFALQRLVSQGKLDVYEKVSAYLPGFKDQPGDLIKGKDKIRVIDV
FT                   LQHQSGLPSSFYFYTPEKAGKYYSQERDKTIEYLTKIPLDYQTGTKHVYSDIGYMLLGC
FT                   IVEKLTGKPLDVYTEQELYKPLRLKHTLYNPLQKGFKPKQFAATERMGNTRDGVIQFPN
FT                   IRTNTLQGEVHDEKAFYSMDGVSGHAGLFSNADDMAILLQVMLNKGSYRNISLFDQKTA
FT                   DLFTAPSATDPTFALGWRRNGSKSMEWMFGPHASENAYGHTGWTGTVTIIDPAYNLGIA
FT                   LLTNKKHTPVIDPEENPNVFEGDQFPTGSYGSVITAIYEAME"
     MKTKTLFIFS AILTLSIFAP NETFAQTAGN LIEPKIINAE TAQFSTKKLR KVDQMIERDI        60
     AAGFPGAVLV VVKDGRIIKK AAYGYSKKYE GSELLRRPAK MKTRTMFDLA SNTKMYATNF       120
     ALQRLVSQGK LDVYEKVSAY LPGFKDQPGD LIKGKDKIRV IDVLQHQSGL PSSFYFYTPE       180
     KAGKYYSQER DKTIEYLTKI PLDYQTGTKH VYSDIGYMLL GCIVEKLTGK PLDVYTEQEL       240
     YKPLRLKHTL YNPLQKGFKP KQFAATERMG NTRDGVIQFP NIRTNTLQGE VHDEKAFYSM       300
     DGVSGHAGLF SNADDMAILL QVMLNKGSYR NISLFDQKTA DLFTAPSATD PTFALGWRRN       360
     GSKSMEWMFG PHASENAYGH TGWTGTVTII DPAYNLGIAL LTNKKHTPVI DPEENPNVFE       420
     GDQFPTGSYG SVITAIYEAM E                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page