(data stored in SCRATCH zone)

EMBL: AL009126.ANSZ

AL009126.ANSZ        Location/Qualifiers
FT   CDS             290915..292042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansZ"
FT                   /locus_tag="BSU_02690"
FT                   /old_locus_tag="BSU02690"
FT                   /product="L-asparaginase 2 (putative lipoprotein)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11914346, 17686772; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12063"
FT                   /db_xref="GOA:O34482"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="SubtiList:BG12755"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34482"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11914346, 17686772"
FT                   /protein_id="CAB12063.1"
FT                   /translation="MKKQRMLVLFTALLFVFTGCSHSPETKESPKEKAQTQKVSSASAS
FT                   EKKDLPNIRILATGGTIAGADQSKTSTTEYKAGVVGVESLIEAVPEMKDIANVSGEQIV
FT                   NVGSTNIDNKILLKLAKRINHLLASDDVDGIVVTHGTDTLEETAYFLNLTVKSDKPVVI
FT                   VGSMRPSTAISADGPSNLYNAVKVAGAPEAKGKGTLVVLNDRIASARYVTKTNTTTTDT
FT                   FKSEEMGFVGTIADDIYFNNEITRKHTKDTDFSVSNLDELPQVDIIYGYQNDGSYLFDA
FT                   AVKAGAKGIVFAGSGNGSLSDAAEKGADSAVKKGVTVVRSTRTGNGVVTPNQDYAEKDL
FT                   LASNSLNPQKARMLLMLALTKTNDPQKIQAYFNEY"
     MKKQRMLVLF TALLFVFTGC SHSPETKESP KEKAQTQKVS SASASEKKDL PNIRILATGG        60
     TIAGADQSKT STTEYKAGVV GVESLIEAVP EMKDIANVSG EQIVNVGSTN IDNKILLKLA       120
     KRINHLLASD DVDGIVVTHG TDTLEETAYF LNLTVKSDKP VVIVGSMRPS TAISADGPSN       180
     LYNAVKVAGA PEAKGKGTLV VLNDRIASAR YVTKTNTTTT DTFKSEEMGF VGTIADDIYF       240
     NNEITRKHTK DTDFSVSNLD ELPQVDIIYG YQNDGSYLFD AAVKAGAKGI VFAGSGNGSL       300
     SDAAEKGADS AVKKGVTVVR STRTGNGVVT PNQDYAEKDL LASNSLNPQK ARMLLMLALT       360
     KTNDPQKIQA YFNEY                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page