(data stored in ACNUC7421 zone)

EMBL: AL009126.AROK

AL009126.AROK        Location/Qualifiers
FT   CDS             340025..340585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BSU_03150"
FT                   /old_locus_tag="BSU03150"
FT                   /product="shikimate kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.71"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 170268, 7612934, 27339308;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12109"
FT                   /db_xref="GOA:P37944"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="SubtiList:BG10457"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37944"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12109.2"
FT                   /translation="MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQ
FT                   IEKDFNMSIPEIFEKKGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLE
FT                   NCLVLHLDLSWENWKQRADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNL
FT                   SPEEVADYIVETLKIGWDLYQPM"
     MNAKRAIPVR ERNIVLIGFM GVGKTTIGQL VAKKLYRDFI DIDQQIEKDF NMSIPEIFEK        60
     KGEDFFRKTE KEYILDICHH KRFKIVSLGG GSFKQEEIRN CCLENCLVLH LDLSWENWKQ       120
     RADLLIESRP VLHNRSMDEM EQLFNERKVI YDKHNSKVAT DNLSPEEVAD YIVETLKIGW       180
     DLYQPM                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page