(data stored in SCRATCH zone)

EMBL: AL009126.BSDD

AL009126.BSDD        Location/Qualifiers
FT   CDS             414595..414822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bsdD"
FT                   /locus_tag="BSU_03651"
FT                   /old_locus_tag="BSU03651"
FT                   /product="phenolic acid decarboxylase subunit"
FT                   /function="3.2: Degradation"
FT                   /EC_number="4.1.1.61"
FT                   /EC_number="4.1.1.91"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 1b: Function from experimental evidences in
FT                   the studied species; PubMedId: 15979273, 17295427,
FT                   18388975, 26658822; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03651"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52546"
FT                   /db_xref="GOA:C0H3U9"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3U9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52546.1"
FT                   /translation="MHTCPRCDSKKGEVMSKSPVEGAWEVYQCQTCFFTWRSCEPESIT
FT                   NPEKYNPAFKIDPKETETAIEVPAVPERKA"
     MHTCPRCDSK KGEVMSKSPV EGAWEVYQCQ TCFFTWRSCE PESITNPEKY NPAFKIDPKE        60
     TETAIEVPAV PERKA                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page