(data stored in ACNUC7421 zone)

EMBL: AL009126.CAH

AL009126.CAH         Location/Qualifiers
FT   CDS             342538..343494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="BSU_03180"
FT                   /old_locus_tag="BSU03180"
FT                   /product="promiscuous acetyl xylan esterase-cephalosporin C
FT                   deacetylase"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.41"
FT                   /EC_number="3.1.1.72"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12842474, 19837798, 21382014;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12112"
FT                   /db_xref="GOA:P94388"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="PDB:1L7A"
FT                   /db_xref="PDB:1ODS"
FT                   /db_xref="PDB:1ODT"
FT                   /db_xref="SubtiList:BG11919"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94388"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12842474, 19837798, 21382014"
FT                   /protein_id="CAB12112.1"
FT                   /translation="MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQ
FT                   PVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVN
FT                   WALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEV
FT                   ISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPY
FT                   LEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAY
FT                   NHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG"
     MQLFDLPLDQ LQTYKPEKTA PKDFSEFWKL SLEELAKVQA EPDLQPVDYP ADGVKVYRLT        60
     YKSFGNARIT GWYAVPDKEG PHPAIVKYHG YNASYDGEIH EMVNWALHGY ATFGMLVRGQ       120
     QSSEDTSISP HGHALGWMTK GILDKDTYYY RGVYLDAVRA LEVISSFDEV DETRIGVTGG       180
     SQGGGLTIAA AALSDIPKAA VADYPYLSNF ERAIDVALEQ PYLEINSFFR RNGSPETEVQ       240
     AMKTLSYFDI MNLADRVKVP VLMSIGLIDK VTPPSTVFAA YNHLETKKEL KVYRYFGHEY       300
     IPAFQTEKLA FFKQHLKG                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page