(data stored in SCRATCH zone)

EMBL: AL009126.CDAA

AL009126.CDAA        Location/Qualifiers
FT   CDS             196213..197034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaA"
FT                   /locus_tag="BSU_01750"
FT                   /old_locus_tag="BSU01750"
FT                   /product="diadenylate cyclase"
FT                   /function="16.3: Control"
FT                   /function="16.6: Maintain"
FT                   /function="16.13: Shape"
FT                   /EC_number="2.7.7.85"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 19901023, 21566650, 23192352,
FT                   25605729, 25616256, 26240071, 28420751; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11951"
FT                   /db_xref="GOA:Q45589"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="SubtiList:BG11577"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45589"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:19901023, 21566650, 23192352, 25605729, 25616256,
FT                   26240071, 28420751"
FT                   /protein_id="CAB11951.2"
FT                   /translation="MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIV
FT                   VIVLVRMASQYLGLSTLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   VEEAQQKTIEAITKAINYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKNNEIAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVS
FT                   EETGGVSVAKNGDLHRELTEEALKEMLEAEFKKNTRDTSSNRWYWRGKKNG"
     MAFEDIPFLQ YLGNAVDILL VWYVIYKLIM VIRGTKAVQL LKGIVVIVLV RMASQYLGLS        60
     TLQWLMDQAI TWGFLAIIII FQPELRRALE QLGRGRFFSR SGTPVEEAQQ KTIEAITKAI       120
     NYMAKRRIGA LLTIERDTGM GDYIETGIPL NAKVSSELLI NIFIPNTPLH DGAVIMKNNE       180
     IAAAACYLPL SESPFISKEL GTRHRAAVGI SEVTDSLTII VSEETGGVSV AKNGDLHREL       240
     TEEALKEMLE AEFKKNTRDT SSNRWYWRGK KNG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page