(data stored in SCRATCH zone)

EMBL: AL009126.CESB

AL009126.CESB        Location/Qualifiers
FT   CDS             246658..247548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cesB"
FT                   /locus_tag="BSU_02260"
FT                   /old_locus_tag="BSU02260"
FT                   /product="enantioselective carboxylesterase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11389736, 24418394; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02260"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12020"
FT                   /db_xref="GOA:O31452"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4CCY"
FT                   /db_xref="SubtiList:BG12740"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31452"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11389736, 24418394"
FT                   /protein_id="CAB12020.1"
FT                   /translation="MIQDSMQFAAVESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTH
FT                   IIASGPKDAPSLILLHGGLFSSAMWYPNIAAWSSQFRTYAVDIIGDKNKSIPSAAMETR
FT                   ADFAEWMKDVFDSLGLETAHLAGLSLGGSHIVNFLLRAPERVERAVVISPAEAFISFHP
FT                   DVYKYAAELTGARGAESYIKWITGDSYDLHPLLQRQIVAGVEWQDEQRSLKPTENGFPY
FT                   VFTDQELKSIQVPVLLMFGEHEAMYHQQMAFERASVLVPGIQAEIVKNAGHLLSLEQPE
FT                   YVNQRVLSFLCGGIK"
     MIQDSMQFAA VESGLRFYQA YDQSLSLWPI ESEAFYVSTR FGKTHIIASG PKDAPSLILL        60
     HGGLFSSAMW YPNIAAWSSQ FRTYAVDIIG DKNKSIPSAA METRADFAEW MKDVFDSLGL       120
     ETAHLAGLSL GGSHIVNFLL RAPERVERAV VISPAEAFIS FHPDVYKYAA ELTGARGAES       180
     YIKWITGDSY DLHPLLQRQI VAGVEWQDEQ RSLKPTENGF PYVFTDQELK SIQVPVLLMF       240
     GEHEAMYHQQ MAFERASVLV PGIQAEIVKN AGHLLSLEQP EYVNQRVLSF LCGGIK           296
//

If you have problems or comments...

PBIL Back to PBIL home page