(data stored in SCRATCH zone)

EMBL: AL009126.COAX

AL009126.COAX        Location/Qualifiers
FT   CDS             79092..79868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BSU_00700"
FT                   /old_locus_tag="BSU00700"
FT                   /product="pantothenate kinase type III"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.33"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15795230, 16905099, 24784177;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11846"
FT                   /db_xref="GOA:P37564"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="SubtiList:BG10133"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37564"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15795230, 16905099, 24784177"
FT                   /protein_id="CAB11846.2"
FT                   /translation="MLLVIDVGNTNTVLGVYHDGKLEYHWRIETSRHKTEDEFGMILRS
FT                   LFDHSGLMFEQIDGIIISSVVPPIMFALERMCTKYFHIEPQIVGPGMKTGLNIKYDNPK
FT                   EVGADRIVNAVAAIHLYGNPLIVVDFGTATTYCYIDENKQYMGGAIAPGITISTEALYS
FT                   RAAKLPRIEITRPDNIIGKNTVSAMQSGILFGYVGQVEGIVKRMKWQAKQEPKVIATGG
FT                   LAPLIANESDCIDIVDPFLTLKGLELIYERNRVGSV"
     MLLVIDVGNT NTVLGVYHDG KLEYHWRIET SRHKTEDEFG MILRSLFDHS GLMFEQIDGI        60
     IISSVVPPIM FALERMCTKY FHIEPQIVGP GMKTGLNIKY DNPKEVGADR IVNAVAAIHL       120
     YGNPLIVVDF GTATTYCYID ENKQYMGGAI APGITISTEA LYSRAAKLPR IEITRPDNII       180
     GKNTVSAMQS GILFGYVGQV EGIVKRMKWQ AKQEPKVIAT GGLAPLIANE SDCIDIVDPF       240
     LTLKGLELIY ERNRVGSV                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page