(data stored in ACNUC7421 zone)

EMBL: AL009126.CSGA

AL009126.CSGA        Location/Qualifiers
FT   CDS             228066..228314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgA"
FT                   /locus_tag="BSU_02070"
FT                   /old_locus_tag="BSU02070"
FT                   /product="sporulation-specific SASP protein"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9016963; Product type cp:
FT                   cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12001"
FT                   /db_xref="GOA:P54379"
FT                   /db_xref="InterPro:IPR020255"
FT                   /db_xref="SubtiList:BG11504"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54379"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9016963"
FT                   /protein_id="CAB12001.1"
FT                   /translation="MDVTLGYLRESLSNHLENEVCQRICKKMLAKRYANEEEFVKDLDD
FT                   NEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL"
     MDVTLGYLRE SLSNHLENEV CQRICKKMLA KRYANEEEFV KDLDDNEMSF LNHVLEKEIK        60
     YAQNEQDQKR AKELNEVYEL LL                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page