(data stored in ACNUC7421 zone)

EMBL: AL009126.CTC

AL009126.CTC         Location/Qualifiers
FT   CDS             58783..59397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="BSU_00520"
FT                   /old_locus_tag="BSU00520"
FT                   /product="ribosomal protein BL25 (Ctc), binding 5S RNA"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8522540, 9669336, 10369900,
FT                   12432960, 17198710; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00520"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11828"
FT                   /db_xref="GOA:P14194"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="SubtiList:BG10115"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14194"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8522540, 9669336, 10369900, 12432960, 17198710"
FT                   /protein_id="CAB11828.1"
FT                   /translation="MATLTAKERTDFTRSSLRNIRTSGHVPGIIYGKDTGNKPVSLDSV
FT                   ELIKTLRDEGKNAVITLEVSGEKHSVMVTDLQTDPLKNEITHADFQVVNMSEDIEVEVP
FT                   IHLTGEAIGVKNGGVLQQPLYALTVKAKPKAIPQTIEADISSLDVNEVLTIADLPAGGD
FT                   YSFNHESDEVVASILPPQQQEAAEVDEEESADAQPEGENEQ"
     MATLTAKERT DFTRSSLRNI RTSGHVPGII YGKDTGNKPV SLDSVELIKT LRDEGKNAVI        60
     TLEVSGEKHS VMVTDLQTDP LKNEITHADF QVVNMSEDIE VEVPIHLTGE AIGVKNGGVL       120
     QQPLYALTVK AKPKAIPQTI EADISSLDVN EVLTIADLPA GGDYSFNHES DEVVASILPP       180
     QQQEAAEVDE EESADAQPEG ENEQ                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page