(data stored in ACNUC7421 zone)

EMBL: AL009126.CUTI

AL009126.CUTI        Location/Qualifiers
FT   CDS             complement(446174..446788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutI"
FT                   /locus_tag="BSU_03940"
FT                   /old_locus_tag="BSU03940"
FT                   /product="putative membrane protein involved in copper
FT                   intake"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 19168619, 22904286,
FT                   27010565, 26822828; Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12202"
FT                   /db_xref="GOA:P94431"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="SubtiList:BG12045"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94431"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12202.1"
FT                   /translation="MLKKIALTLCPAIVGSLLFFTAPASAHVSVKPAESAAGSWETYTM
FT                   KVPSEKNLPTTKVVLKMPKDVEFQQYEPIPGWKVSTQKHDDKSVSVTWEATDGGIQEGQ
FT                   FQQFTFVAKNPDKAEEAAWDAYQYYKDGSIVEWTGDEDADTPHSITNITSAKQVTDEHG
FT                   ATKTEDDSENSGSSALDITAMVLSAAAIILSVAALVKKKRA"
     MLKKIALTLC PAIVGSLLFF TAPASAHVSV KPAESAAGSW ETYTMKVPSE KNLPTTKVVL        60
     KMPKDVEFQQ YEPIPGWKVS TQKHDDKSVS VTWEATDGGI QEGQFQQFTF VAKNPDKAEE       120
     AAWDAYQYYK DGSIVEWTGD EDADTPHSIT NITSAKQVTD EHGATKTEDD SENSGSSALD       180
     ITAMVLSAAA IILSVAALVK KKRA                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page