(data stored in ACNUC7421 zone)

EMBL: AL009126.CUTJ

AL009126.CUTJ        Location/Qualifiers
FT   CDS             complement(446801..448426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutJ"
FT                   /locus_tag="BSU_03950"
FT                   /old_locus_tag="BSU03950"
FT                   /product="copper import permease subunit"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15101989, 15849754, 16850406,
FT                   19168619, 22904286, 23012364; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12203"
FT                   /db_xref="GOA:C0SP95"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="SubtiList:BG12046"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SP95"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15101989, 15849754, 16850406, 19168619, 22904286,
FT                   23012364"
FT                   /protein_id="CAB12203.2"
FT                   /translation="MKRNRWWIILLLFLVFLPKTSFAHAYIVKSSPGENSELKSAPAQV
FT                   EIEFNEPVEEGFHYIKVYNSNGDRVDTDKTEIKKDNHHIMTVKLKKNLPKDVYRAEWNA
FT                   VSADGHPVSGVIPFSIGKADGGFSSQKAADSALNPGTAADRAILYTALSLFIGTVFFHL
FT                   FWYKGKSEQLVKRTRRILTGSIAALGLALLLQLPIQTKANAGGGWGSAFQPGYIRETLF
FT                   ETAGGSIWIIQAALFVLLALSVIPAIRKNRFSSFGYWTAPLIFFFGLLLAKAFTGHAAV
FT                   VEEKTVGILMDFLHLTSASIWVGGIAALVLLLSKEWRQPDKTLAWETVRRFSPWALTAV
FT                   GVILFSGLLNGFFIIRSMDSLFHTAYGQALLVKSGLFVFMLVLGAIHFLLTRKQRRTGI
FT                   SRTLKAEWAIGIAVLITAAVFTSLPSPPEPAPEPFYQTKAIENGQSVSLSISPNQPGKN
FT                   VFELRVTDHNGDPVKNIQQITLTVYKTGLSGSENKSTFTLKEKTKGVFQDQNLSINEKG
FT                   NWKIKVHGLTGDFNEINIMFTKTN"
     MKRNRWWIIL LLFLVFLPKT SFAHAYIVKS SPGENSELKS APAQVEIEFN EPVEEGFHYI        60
     KVYNSNGDRV DTDKTEIKKD NHHIMTVKLK KNLPKDVYRA EWNAVSADGH PVSGVIPFSI       120
     GKADGGFSSQ KAADSALNPG TAADRAILYT ALSLFIGTVF FHLFWYKGKS EQLVKRTRRI       180
     LTGSIAALGL ALLLQLPIQT KANAGGGWGS AFQPGYIRET LFETAGGSIW IIQAALFVLL       240
     ALSVIPAIRK NRFSSFGYWT APLIFFFGLL LAKAFTGHAA VVEEKTVGIL MDFLHLTSAS       300
     IWVGGIAALV LLLSKEWRQP DKTLAWETVR RFSPWALTAV GVILFSGLLN GFFIIRSMDS       360
     LFHTAYGQAL LVKSGLFVFM LVLGAIHFLL TRKQRRTGIS RTLKAEWAIG IAVLITAAVF       420
     TSLPSPPEPA PEPFYQTKAI ENGQSVSLSI SPNQPGKNVF ELRVTDHNGD PVKNIQQITL       480
     TVYKTGLSGS ENKSTFTLKE KTKGVFQDQN LSINEKGNWK IKVHGLTGDF NEINIMFTKT       540
     N                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page