(data stored in SCRATCH zone)

EMBL: AL009126.CWLD

AL009126.CWLD        Location/Qualifiers
FT   CDS             156612..157325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BSU_01530"
FT                   /old_locus_tag="BSU01530"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /function="16.13: Shape"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.1.28"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14679227, 16267290; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01530"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11929"
FT                   /db_xref="GOA:P50864"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="SubtiList:BG11514"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50864"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14679227, 16267290"
FT                   /protein_id="CAB11929.1"
FT                   /translation="MRKKLKWLSFLLGFIILLFLFKYQFSNNDSWKPWSLPLSGKIIYL
FT                   DPGHGGPDGGAVGGKLLEKDVTLEVAFRVRDYLQEQGALVIMTRESDTDLAPEGTKGYS
FT                   RRKAEDLRQRVKLINHSEAELYISIHLNAIPSQKWSGAQSFYYGKYAENEKVAKYIQDE
FT                   LRRNLENTTRKAKRIHGIYLMQNVTKPGALIEVGFLSNPSEATLLGKPKYQDKVASSIY
FT                   KGILRYFTEKGDPPE"
     MRKKLKWLSF LLGFIILLFL FKYQFSNNDS WKPWSLPLSG KIIYLDPGHG GPDGGAVGGK        60
     LLEKDVTLEV AFRVRDYLQE QGALVIMTRE SDTDLAPEGT KGYSRRKAED LRQRVKLINH       120
     SEAELYISIH LNAIPSQKWS GAQSFYYGKY AENEKVAKYI QDELRRNLEN TTRKAKRIHG       180
     IYLMQNVTKP GALIEVGFLS NPSEATLLGK PKYQDKVASS IYKGILRYFT EKGDPPE          237
//

If you have problems or comments...

PBIL Back to PBIL home page