(data stored in SCRATCH zone)

EMBL: AL009126.CWLJ

AL009126.CWLJ        Location/Qualifiers
FT   CDS             282469..282897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlJ"
FT                   /locus_tag="BSU_02600"
FT                   /old_locus_tag="BSU02600"
FT                   /product="spore cortex cell wall hydrolase"
FT                   /function="16.3: Control"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9515903, 11466292, 11807087,
FT                   12177332, 16936016, 26190134, 28333204; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12054"
FT                   /db_xref="GOA:P42249"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="SubtiList:BG11172"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42249"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9515903, 11466292, 11807087, 12177332, 16936016,
FT                   26190134, 28333204"
FT                   /protein_id="CAB12054.2"
FT                   /translation="MAVVRATSADVDLMARLLRAEAEGEGKQGMLLVGNVGINRLRANC
FT                   SDFKGLRTIRQMIYQPHAFEAVTHGYFYQRARDSERALARRSINGERRWPAKFSLWYFR
FT                   PQGDCPAQWYNQPFVARFKSHCFYQPTAETCENVYNTF"
     MAVVRATSAD VDLMARLLRA EAEGEGKQGM LLVGNVGINR LRANCSDFKG LRTIRQMIYQ        60
     PHAFEAVTHG YFYQRARDSE RALARRSING ERRWPAKFSL WYFRPQGDCP AQWYNQPFVA       120
     RFKSHCFYQP TAETCENVYN TF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page