(data stored in ACNUC7421 zone)

EMBL: AL009126.CWLK

AL009126.CWLK        Location/Qualifiers
FT   CDS             complement(303804..304307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlK"
FT                   /locus_tag="BSU_02810"
FT                   /old_locus_tag="BSU02810"
FT                   /product="murein L,D:-endopeptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.-.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17588176; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12075"
FT                   /db_xref="GOA:O34360"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="SubtiList:BG12760"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34360"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17588176"
FT                   /protein_id="CAB12075.1"
FT                   /translation="MNLPAKTFVILCILFLLDLCFSYIRHEWHSQNALQDMPVPSDLHP
FT                   IVKQNADALKAAAANKGIDVVITEGFRSFKEQDELYKQGRTKKGNIVTYARGGESYHNY
FT                   GLAIDFALQKKDGSIIWDMEYDGNQNGKSDWLEVVEIAKTLGFEWGGDWKRFKDYPHLE
FT                   MIPN"
     MNLPAKTFVI LCILFLLDLC FSYIRHEWHS QNALQDMPVP SDLHPIVKQN ADALKAAAAN        60
     KGIDVVITEG FRSFKEQDEL YKQGRTKKGN IVTYARGGES YHNYGLAIDF ALQKKDGSII       120
     WDMEYDGNQN GKSDWLEVVE IAKTLGFEWG GDWKRFKDYP HLEMIPN                     167
//

If you have problems or comments...

PBIL Back to PBIL home page