(data stored in ACNUC7421 zone)

EMBL: AL009126.CYPC

AL009126.CYPC        Location/Qualifiers
FT   CDS             229525..230778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypC"
FT                   /locus_tag="BSU_02100"
FT                   /old_locus_tag="BSU02100"
FT                   /product="fatty acid beta-hydroxylating cytochrome P450"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.11.2.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10529095, 12519760, 21673922;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12004"
FT                   /db_xref="GOA:O31440"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:1IZO"
FT                   /db_xref="PDB:2ZQJ"
FT                   /db_xref="PDB:2ZQX"
FT                   /db_xref="SubtiList:BG12729"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31440"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10529095, 12519760, 21673922"
FT                   /protein_id="CAB12004.1"
FT                   /translation="MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGKN
FT                   FICMTGAEAAKVFYDTDRFQRQNALPKRVQKSLFGVNAIQGMDGSAHIHRKMLFLSLMT
FT                   PPHQKRLAELMTEEWKAAVTRWEKADEVVLFEEAKEILCRVACYWAGVPLKETEVKERA
FT                   DDFIDMVDAFGAVGPRHWKGRRARPRAEEWIEVMIEDARAGLLKTTSGTALHEMAFHTQ
FT                   EDGSQLDSRMAAIELINVLRPIVAISYFLVFSALALHEHPKYKEWLRSGNSREREMFVQ
FT                   EVRRYYPFGPFLGALVKKDFVWNNCEFKKGTSVLLDLYGTNHDPRLWDHPDEFRPERFA
FT                   EREENLFDMIPQGGGHAEKGHRCPGEGITIEVMKASLDFLVHQIEYDVPEQSLHYSLAR
FT                   MPSLPESGFVMSGIRRKS"
     MNEQIPHDKS LDNSLTLLKE GYLFIKNRTE RYNSDLFQAR LLGKNFICMT GAEAAKVFYD        60
     TDRFQRQNAL PKRVQKSLFG VNAIQGMDGS AHIHRKMLFL SLMTPPHQKR LAELMTEEWK       120
     AAVTRWEKAD EVVLFEEAKE ILCRVACYWA GVPLKETEVK ERADDFIDMV DAFGAVGPRH       180
     WKGRRARPRA EEWIEVMIED ARAGLLKTTS GTALHEMAFH TQEDGSQLDS RMAAIELINV       240
     LRPIVAISYF LVFSALALHE HPKYKEWLRS GNSREREMFV QEVRRYYPFG PFLGALVKKD       300
     FVWNNCEFKK GTSVLLDLYG TNHDPRLWDH PDEFRPERFA EREENLFDMI PQGGGHAEKG       360
     HRCPGEGITI EVMKASLDFL VHQIEYDVPE QSLHYSLARM PSLPESGFVM SGIRRKS          417
//

If you have problems or comments...

PBIL Back to PBIL home page