(data stored in ACNUC7421 zone)

EMBL: AL009126.CYSE

AL009126.CYSE        Location/Qualifiers
FT   CDS             112800..113453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BSU_00930"
FT                   /old_locus_tag="BSU00930"
FT                   /product="serine O-acetyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="2.3.1.30"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7510287, 10737181, 10939241,
FT                   17056751, 18974048, 25731080; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00930"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11869"
FT                   /db_xref="GOA:Q06750"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="SubtiList:BG10155"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06750"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7510287, 10737181, 10939241, 17056751, 18974048,
FT                   25731080"
FT                   /protein_id="CAB11869.1"
FT                   /translation="MFFRMLKEDIDTVFDQDPAARSYFEVILTYSGLHAIWAHRIAHAL
FT                   YKRKFYFLARLISQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGNNVTVFQG
FT                   VTLGGTGKEKGKRHPTIKDDALIATGAKVLGSITVGEGSKIGAGSVVLHDVPDFSTVVG
FT                   IPGRVVVQNGKKVRRDLNHQDLPDPVADRFKSLEQQILELKAELEDRKERINQK"
     MFFRMLKEDI DTVFDQDPAA RSYFEVILTY SGLHAIWAHR IAHALYKRKF YFLARLISQV        60
     SRFFTGIEIH PGATIGRRFF IDHGMGVVIG ETCEIGNNVT VFQGVTLGGT GKEKGKRHPT       120
     IKDDALIATG AKVLGSITVG EGSKIGAGSV VLHDVPDFST VVGIPGRVVV QNGKKVRRDL       180
     NHQDLPDPVA DRFKSLEQQI LELKAELEDR KERINQK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page