(data stored in ACNUC7421 zone)

EMBL: AL009126.CYSK

AL009126.CYSK        Location/Qualifiers
FT   CDS             81771..82697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BSU_00730"
FT                   /old_locus_tag="BSU00730"
FT                   /product="cysteine synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.3: Control"
FT                   /EC_number="2.5.1.47"
FT                   /EC_number="4.4.1.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11390694, 15760717, 16267287,
FT                   16513748, 17056751, 18974048; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11849"
FT                   /db_xref="GOA:P37887"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="SubtiList:BG10136"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37887"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11390694, 15760717, 16267287, 16513748, 17056751,
FT                   18974048"
FT                   /protein_id="CAB11849.1"
FT                   /translation="MVRVANSITELIGNTPIVKLNRLADENSADVYLKLEYMNPGSSVK
FT                   DRIGLAMIEAAEKEGKLKAGNTIIEPTSGNTGIGLAMVAAAKGLKAILVMPDTMSMERR
FT                   NLLRAYGAELVLTPGAEGMKGAIKKAEELAEKHGYFVPQQFNNPSNPEIHRQTTGKEIV
FT                   EQFGDDQLDAFVAGIGTGGTITGAGEVLKEAYPSIKIYAVEPSDSPVLSGGKPGPHKIQ
FT                   GIGAGFVPDILNTEVYDEIFPVKNEEAFEYARRAAREEGILGGISSGAAIYAALQVAKK
FT                   LGKGKKVLAIIPSNGERYLSTPLYQFD"
     MVRVANSITE LIGNTPIVKL NRLADENSAD VYLKLEYMNP GSSVKDRIGL AMIEAAEKEG        60
     KLKAGNTIIE PTSGNTGIGL AMVAAAKGLK AILVMPDTMS MERRNLLRAY GAELVLTPGA       120
     EGMKGAIKKA EELAEKHGYF VPQQFNNPSN PEIHRQTTGK EIVEQFGDDQ LDAFVAGIGT       180
     GGTITGAGEV LKEAYPSIKI YAVEPSDSPV LSGGKPGPHK IQGIGAGFVP DILNTEVYDE       240
     IFPVKNEEAF EYARRAAREE GILGGISSGA AIYAALQVAK KLGKGKKVLA IIPSNGERYL       300
     STPLYQFD                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page