(data stored in ACNUC7421 zone)

EMBL: AL009126.CYSS

AL009126.CYSS        Location/Qualifiers
FT   CDS             113450..114850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BSU_00940"
FT                   /old_locus_tag="BSU00940"
FT                   /product="dual cysteinyl-tRNA synthetase; cysteine
FT                   persulfide synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10024179, 10546897, 10931887,
FT                   12682299, 29079736; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00940"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11870"
FT                   /db_xref="GOA:Q06752"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="SubtiList:BG10156"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06752"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10024179, 10546897, 10931887, 12682299, 29079736"
FT                   /protein_id="CAB11870.1"
FT                   /translation="MTITLYNTLTRQKETFVPLEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVYDTVRNYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTISERFIKAYFEDVGAL
FT                   GCRKADLHPRVMENMDAIIEFVDQLVKKGYAYESEGDVYFKTRAFEGYGKLSQQSIDEL
FT                   RSGARIRVGEKKEDALDFALWKAAKEGEISWDSPWGKGRPGWHIECSAMVKKYLGDQID
FT                   IHAGGQDLTFPHHENEIAQSEALTGKTFAKYWLHNGYINIDNEKMSKSLGNFVLVHDII
FT                   KQHDPQLLRFFMLSVHYRHPINYSEELLENTKSAFSRLKTAYSNLQHRLNSSTNLTEDD
FT                   DQWLEKVEEHRKAFEEEMDDDFNTANAISVLFDLAKHANYYLQKDHTADHVITAFIEMF
FT                   DRIVSVLGFSLGEQELLDQEIEDLIEKRNEARRNRDFALSDQIRDQLKSMNIILEDTAQ
FT                   GTRWKRGE"
     MTITLYNTLT RQKETFVPLE EGKVKMYVCG PTVYNYIHIG NARPAIVYDT VRNYLEYKGY        60
     DVQYVSNFTD VDDKLIKAAN ELGEDVPTIS ERFIKAYFED VGALGCRKAD LHPRVMENMD       120
     AIIEFVDQLV KKGYAYESEG DVYFKTRAFE GYGKLSQQSI DELRSGARIR VGEKKEDALD       180
     FALWKAAKEG EISWDSPWGK GRPGWHIECS AMVKKYLGDQ IDIHAGGQDL TFPHHENEIA       240
     QSEALTGKTF AKYWLHNGYI NIDNEKMSKS LGNFVLVHDI IKQHDPQLLR FFMLSVHYRH       300
     PINYSEELLE NTKSAFSRLK TAYSNLQHRL NSSTNLTEDD DQWLEKVEEH RKAFEEEMDD       360
     DFNTANAISV LFDLAKHANY YLQKDHTADH VITAFIEMFD RIVSVLGFSL GEQELLDQEI       420
     EDLIEKRNEA RRNRDFALSD QIRDQLKSMN IILEDTAQGT RWKRGE                      466
//

If you have problems or comments...

PBIL Back to PBIL home page