(data stored in SCRATCH zone)

EMBL: AL009126.DACA

AL009126.DACA        Location/Qualifiers
FT   CDS             17534..18865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BSU_00100"
FT                   /old_locus_tag="BSU00100"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /EC_number="3.4.16.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8370539, 9864321, 10383963,
FT                   21378199; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00100"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11786"
FT                   /db_xref="GOA:P08750"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="SubtiList:BG10074"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08750"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8370539, 9864321, 10383963, 21378199"
FT                   /protein_id="CAB11786.1"
FT                   /translation="MNIKKCKQLLMSLVVLTLAVTCLAPMSKAKAASDPIDINASAAIM
FT                   IEASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTYTPDDYVYEISQD
FT                   NSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFVEKMNAKAKELGL
FT                   TDYKFVNATGLENKDLHGHQPEGTSVNEESEVSAKDMAVLADHLITDYPEILETSSIAK
FT                   TKFREGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCFTGTAERNGMRVI
FT                   TVVLNAKGNLHTGRFDETKKMFDYAFDNFSMKEIYAEGDQVKGHKTISVDKGKEKEVGI
FT                   VTNKAFSLPVKNGEEKNYKAKVTLNKDNLTAPVKKGTKVGKLTAEYTGDEKDYGFLNSD
FT                   LAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF"
     MNIKKCKQLL MSLVVLTLAV TCLAPMSKAK AASDPIDINA SAAIMIEASS GKILYSKNAD        60
     KRLPIASMTK MMTEYLLLEA IDQGKVKWDQ TYTPDDYVYE ISQDNSLSNV PLRKDGKYTV       120
     KELYQATAIY SANAAAIAIA EIVAGSETKF VEKMNAKAKE LGLTDYKFVN ATGLENKDLH       180
     GHQPEGTSVN EESEVSAKDM AVLADHLITD YPEILETSSI AKTKFREGTD DEMDMPNWNF       240
     MLKGLVSEYK KATVDGLKTG STDSAGSCFT GTAERNGMRV ITVVLNAKGN LHTGRFDETK       300
     KMFDYAFDNF SMKEIYAEGD QVKGHKTISV DKGKEKEVGI VTNKAFSLPV KNGEEKNYKA       360
     KVTLNKDNLT APVKKGTKVG KLTAEYTGDE KDYGFLNSDL AGVDLVTKEN VEKANWFVLT       420
     MRSIGGFFAG IWGSIVDTVT GWF                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page