(data stored in SCRATCH zone)

EMBL: AL009126.DARA

AL009126.DARA        Location/Qualifiers
FT   CDS             39871..40200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="darA"
FT                   /locus_tag="BSU_00290"
FT                   /old_locus_tag="BSU00290"
FT                   /product="signal transduction receptor, cyclic di-AMP
FT                   binding"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10913081, 25433025; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11805"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="PDB:4RLE"
FT                   /db_xref="SubtiList:BG10093"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37538"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10913081, 25433025"
FT                   /protein_id="CAB11805.1"
FT                   /translation="MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFM
FT                   IGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVD
FT                   EFHQF"
     MKLIVAVVQD QDSNRLLKTL TDHNFRVTKL ATTGGFLKSG NTTFMIGVED IRVNKALSLI        60
     KENGQKRDQM IAPVSPMGGN ADSYVPYPVE VEVGGATVFV LPVDEFHQF                   109
//

If you have problems or comments...

PBIL Back to PBIL home page