(data stored in ACNUC7421 zone)

EMBL: AL009126.DAYD

AL009126.DAYD        Location/Qualifiers
FT   CDS             47706..48473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dayD"
FT                   /locus_tag="BSU_00390"
FT                   /old_locus_tag="BSU00390"
FT                   /product="D-amino acyl-tRNA deacylase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10747959, 16014871, 16461678,
FT                   19332551; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11815"
FT                   /db_xref="GOA:P37545"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="SubtiList:BG10102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37545"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11815.1"
FT                   /translation="MLFDTHAHLNAEQYDTDLEEVIERAKAEKVERIVVVGFDRPTITR
FT                   AMEMIEEYDFIYAAIGWHPVDAIDMTEEDLAWIKELSAHEKVVAIGEMGLDYHWDKSPK
FT                   DIQKEVFRNQIALAKEVNLPIIIHNRDATEDVVTILKEEGAEAVGGIMHCFTGSAEVAR
FT                   ECMKMNFYLSFGGPVTFKNAKKPKEVVKEIPNDRLLIETDCPFLTPHPFRGKRNEPSYV
FT                   KYVAEQIAELKEMTFEEIASITTENAKRLFRIN"
     MLFDTHAHLN AEQYDTDLEE VIERAKAEKV ERIVVVGFDR PTITRAMEMI EEYDFIYAAI        60
     GWHPVDAIDM TEEDLAWIKE LSAHEKVVAI GEMGLDYHWD KSPKDIQKEV FRNQIALAKE       120
     VNLPIIIHNR DATEDVVTIL KEEGAEAVGG IMHCFTGSAE VARECMKMNF YLSFGGPVTF       180
     KNAKKPKEVV KEIPNDRLLI ETDCPFLTPH PFRGKRNEPS YVKYVAEQIA ELKEMTFEEI       240
     ASITTENAKR LFRIN                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page