(data stored in ACNUC7421 zone)

EMBL: AL009126.DCK

AL009126.DCK         Location/Qualifiers
FT   CDS             complement(22496..23149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dck"
FT                   /locus_tag="BSU_00140"
FT                   /old_locus_tag="BSU00140"
FT                   /product="deoxyadenosine/deoxycytidine kinase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.76"
FT                   /EC_number="2.7.1.74"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 6251049, 11078735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00140"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11790"
FT                   /db_xref="GOA:P37529"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="SubtiList:BG10078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37529"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:6251049, 11078735"
FT                   /protein_id="CAB11790.1"
FT                   /translation="MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHN
FT                   PYLEKFYHDFERWSFHLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADK
FT                   GTMSKVDYKTYTSLFEAMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSY
FT                   WEEMHTRYENWISGFNACPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK"
     MKEHHIPKNS IITVAGTVGV GKSTLTKTLA KRLGFKTSLE EVDHNPYLEK FYHDFERWSF        60
     HLQIYFLAER FKEQKTIFEA GGGFVQDRSI YEDTGIFAKM HADKGTMSKV DYKTYTSLFE       120
     AMVMTPYFPH PDVLIYLEGD LENILNRIEQ RGREMELQTS RSYWEEMHTR YENWISGFNA       180
     CPVLKLRIED YDLLNDENSI ENIVDQIASV IHDNQKK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page