(data stored in SCRATCH zone)

EMBL: AL009126.DCTB

AL009126.DCTB        Location/Qualifiers
FT   CDS             complement(496646..497698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="BSU_04440"
FT                   /old_locus_tag="BSU04440"
FT                   /product="membrane bound C4-dicarboxylate binding sensor
FT                   protein"
FT                   /function="16.12: Sense"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1809844, 10708364, 11566984,
FT                   24375102; Product type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12251"
FT                   /db_xref="GOA:P96600"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="SubtiList:BG12072"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96600"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1809844, 10708364, 11566984, 24375102"
FT                   /protein_id="CAB12251.1"
FT                   /translation="MKSLLACLALMIAGIATALFIGFHDHTGNKKIVYDDDQEGLQDQI
FT                   VFKFSHVVAENTPKGLAANKFADLVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQ
FT                   FIAPSTSKLGMLSPEWGVLDLPYAFTDYNAVKKGLNGSIGTQLFDSLKKNQLKGLAYWT
FT                   NGFKQITTNQGPVKTPDDLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNV
FT                   VDGEENTISNIYSKKFYNVQDYLTISSHGYLGYAVMTDEHFWKAQTPETRRILTEAMKE
FT                   TTEWNETYAEQMNKEQLEEIKKNSAIHIYELSDKEKQEWMKRLDPVYRQYEPIFGRELI
FT                   RELLELRKDS"
     MKSLLACLAL MIAGIATALF IGFHDHTGNK KIVYDDDQEG LQDQIVFKFS HVVAENTPKG        60
     LAANKFADLV NEKSGGKIKI EVFPNGSLYS DIEEIEALQN GDVQFIAPST SKLGMLSPEW       120
     GVLDLPYAFT DYNAVKKGLN GSIGTQLFDS LKKNQLKGLA YWTNGFKQIT TNQGPVKTPD       180
     DLKGQDLRIM QSDVIEDQFK LLGATPHQES FNSTFQLLEN NVVDGEENTI SNIYSKKFYN       240
     VQDYLTISSH GYLGYAVMTD EHFWKAQTPE TRRILTEAMK ETTEWNETYA EQMNKEQLEE       300
     IKKNSAIHIY ELSDKEKQEW MKRLDPVYRQ YEPIFGRELI RELLELRKDS                  350
//

If you have problems or comments...

PBIL Back to PBIL home page