(data stored in ACNUC7421 zone)

EMBL: AL009126.DGK

AL009126.DGK         Location/Qualifiers
FT   CDS             complement(23146..23769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="BSU_00150"
FT                   /old_locus_tag="BSU00150"
FT                   /product="deoxyguanosine kinase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.113"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11078735; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00150"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11791"
FT                   /db_xref="GOA:P37530"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="SubtiList:BG10079"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37530"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11078735"
FT                   /protein_id="CAB11791.1"
FT                   /translation="MNTAPFIAIEGPIGAGKTTLATMLSQKFGFPMINEIVEDNPYLDK
FT                   FYDNIKEWSFQLEMFFLCHRYKQLEDTSDHFLKKGQPVIADYHIYKNVIFAERTLSPHQ
FT                   LEKYKKIYHLLTDDLPKPNFIIYIKASLPTLLHRIEKRGRPFEKKIETSYLEQLISDYE
FT                   VAIKQLQEADPELTVLTVDGDSKDFVLNKSDFERIAAHVKELIV"
     MNTAPFIAIE GPIGAGKTTL ATMLSQKFGF PMINEIVEDN PYLDKFYDNI KEWSFQLEMF        60
     FLCHRYKQLE DTSDHFLKKG QPVIADYHIY KNVIFAERTL SPHQLEKYKK IYHLLTDDLP       120
     KPNFIIYIKA SLPTLLHRIE KRGRPFEKKI ETSYLEQLIS DYEVAIKQLQ EADPELTVLT       180
     VDGDSKDFVL NKSDFERIAA HVKELIV                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page