(data stored in ACNUC7421 zone)

EMBL: AL009126.DISA

AL009126.DISA        Location/Qualifiers
FT   CDS             107476..108558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /locus_tag="BSU_00880"
FT                   /old_locus_tag="BSU00880"
FT                   /product="diadenylate cyclase; DNA integrity scanning
FT                   protein; cell cycle checkpoint DNA scanning protein"
FT                   /function="16.6: Maintain"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16713562, 21566650, 24939848,
FT                   25616256, 27074767, 27150552, 28511132, 28961460; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00880"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11864"
FT                   /db_xref="GOA:P37573"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="SubtiList:BG10150"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37573"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16713562, 21566650, 24939848, 25616256, 27074767,
FT                   27150552, 28511132, 28961460"
FT                   /protein_id="CAB11864.1"
FT                   /translation="MEKEKKGAKHELDLSSILQFVAPGTPLRAGMENVLRANTGGLIVV
FT                   GYNDKVKEVVDGGFHINTAFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPDATISS
FT                   SETGMRHRTAERVAKQTGCLVIAISERRNVITLYQENMKYTLKDIGFILTKANQAIQTL
FT                   EKYKTILDKTINALNALEFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLI
FT                   KLQVIELITDMEEEAALFIKDYVKEKIKDPFVLLKELQDMSSYDLLDDSIVYKLLGYPA
FT                   STNLDDYVLPRGYRLLNKIPRLPMPIVENVVEAFGVLPRIIEASAEELDEVEGIGEVRA
FT                   QKIKKGLKRLQEKHYLDRQL"
     MEKEKKGAKH ELDLSSILQF VAPGTPLRAG MENVLRANTG GLIVVGYNDK VKEVVDGGFH        60
     INTAFSPAHL YELAKMDGAI ILSDSGQKIL YANTQLMPDA TISSSETGMR HRTAERVAKQ       120
     TGCLVIAISE RRNVITLYQE NMKYTLKDIG FILTKANQAI QTLEKYKTIL DKTINALNAL       180
     EFEELVTFSD VLSVMHRYEM VLRIKNEINM YIKELGTEGH LIKLQVIELI TDMEEEAALF       240
     IKDYVKEKIK DPFVLLKELQ DMSSYDLLDD SIVYKLLGYP ASTNLDDYVL PRGYRLLNKI       300
     PRLPMPIVEN VVEAFGVLPR IIEASAEELD EVEGIGEVRA QKIKKGLKRL QEKHYLDRQL       360
//

If you have problems or comments...

PBIL Back to PBIL home page