(data stored in ACNUC7421 zone)

EMBL: AL009126.DIVIC

AL009126.DIVIC       Location/Qualifiers
FT   CDS             69168..69545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BSU_00620"
FT                   /old_locus_tag="BSU00620"
FT                   /product="cell-division initiation protein"
FT                   /function="16.9: Replicate"
FT                   /function="16.13: Shape"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10844672, 11283287, 11994149,
FT                   12682299, 16936019, 20870765, 22720735; Product type f:
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11838"
FT                   /db_xref="GOA:P37471"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="SubtiList:BG10125"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37471"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10844672, 11283287, 11994149, 12682299, 16936019,
FT                   20870765, 22720735"
FT                   /protein_id="CAB11838.1"
FT                   /translation="MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALV
FT                   FLTAIVLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKLKDEDYVTELA
FT                   RRDLFMSGDGEIIFNVEKKSK"
     MNFSRERTIT EIQNDYKEQV ERQNQLKKRR RKGLYRRLTV FGALVFLTAI VLASSVWSQT        60
     SSLSAKEEKK EQLEKELKSL KTKQTDLKEE ISKLKDEDYV TELARRDLFM SGDGEIIFNV       120
     EKKSK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page