(data stored in SCRATCH zone)

EMBL: AL009126.DNAH

AL009126.DNAH        Location/Qualifiers
FT   CDS             42499..42858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaH"
FT                   /locus_tag="BSU_00330"
FT                   /old_locus_tag="BSU00330"
FT                   /product="subunit of the DNA replication complex"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15927750, 16461910, 19737352,
FT                   21895792, 23909787, 28166228; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11809"
FT                   /db_xref="GOA:P37542"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="PDB:5DOL"
FT                   /db_xref="SubtiList:BG10097"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37542"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15927750, 16461910, 19737352, 21895792, 23909787,
FT                   28166228"
FT                   /protein_id="CAB11809.1"
FT                   /translation="MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLEN
FT                   KHLRKRLDDTTQQIEKFKADKKESKTQKTEQTDIGEGYDNLARLYQEGFHICNVHYGSV
FT                   RKEDCLFCLSFLNKK"
     MDKKELFDTV INLEEQIGSL YRQLGDLKQH IGEMIEENHH LQLENKHLRK RLDDTTQQIE        60
     KFKADKKESK TQKTEQTDIG EGYDNLARLY QEGFHICNVH YGSVRKEDCL FCLSFLNKK        119
//

If you have problems or comments...

PBIL Back to PBIL home page