(data stored in ACNUC7421 zone)

EMBL: AL009126.DNAX

AL009126.DNAX        Location/Qualifiers
FT   CDS             26814..28505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BSU_00190"
FT                   /old_locus_tag="BSU00190"
FT                   /product="DNA polymerase III subunit tau subunit"
FT                   /function="16.9: Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9341154, 10844689, 12466528,
FT                   12974630, 14757052, 15927750, 25850333, 26786318; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11795"
FT                   /db_xref="GOA:P09122"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09122"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9341154, 10844689, 12466528, 12974630, 14757052,
FT                   15927750, 25850333, 26786318"
FT                   /protein_id="CAB11795.2"
FT                   /translation="MSYQALYRVFRPQRFEDVVGQEHITKTLQNALLQKKFSHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEHAPVDEPCNECAACKGITNGSISDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITSQAIVGRMNKIVDAEQLQVEEGSLEIIASAADGGMRDALSLLD
FT                   QAISFSGDILKVEDALLITGAVSQLYIGKLAKSLHDKNVSDALETLNELLQQGKDPAKL
FT                   IEDMIFYFRDMLLYKTAPGLEGVLEKVKVDETFRELSEQIPAQALYEMIDILNKSHQEM
FT                   KWTNHPRIFFEVAVVKICQTSHQSAADLPEVDMLMKKIQQLEQEVERLKTTGIKAAAES
FT                   PKKEAPRVPKGGKSNYKAPVGRIHEILKEATRPDLDLLRNSWGKLLAHLKQQNKVSHAA
FT                   LLNDSEPVAAGSAAFVLKFKYEIHCKMVAEDNNGVRTNLEQILESMLGKRMDLIGVPEA
FT                   QWGKIREEFLEDHQQENEGSNEPAEEDPLIAEAKKLVGADLIEIKD"
     MSYQALYRVF RPQRFEDVVG QEHITKTLQN ALLQKKFSHA YLFSGPRGTG KTSAAKIFAK        60
     AVNCEHAPVD EPCNECAACK GITNGSISDV IEIDAASNNG VDEIRDIRDK VKFAPSAVTY       120
     KVYIIDEVHM LSIGAFNALL KTLEEPPEHC IFILATTEPH KIPLTIISRC QRFDFKRITS       180
     QAIVGRMNKI VDAEQLQVEE GSLEIIASAA DGGMRDALSL LDQAISFSGD ILKVEDALLI       240
     TGAVSQLYIG KLAKSLHDKN VSDALETLNE LLQQGKDPAK LIEDMIFYFR DMLLYKTAPG       300
     LEGVLEKVKV DETFRELSEQ IPAQALYEMI DILNKSHQEM KWTNHPRIFF EVAVVKICQT       360
     SHQSAADLPE VDMLMKKIQQ LEQEVERLKT TGIKAAAESP KKEAPRVPKG GKSNYKAPVG       420
     RIHEILKEAT RPDLDLLRNS WGKLLAHLKQ QNKVSHAALL NDSEPVAAGS AAFVLKFKYE       480
     IHCKMVAEDN NGVRTNLEQI LESMLGKRMD LIGVPEAQWG KIREEFLEDH QQENEGSNEP       540
     AEEDPLIAEA KKLVGADLIE IKD                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page